Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) |
Domain d7cbza2: 7cbz A:246-438 [404686] Other proteins in same PDB: d7cbza1, d7cbzb1, d7cbzc1, d7cbzd1, d7cbze_, d7cbzf1, d7cbzf2 automated match to d4i50a2 complexed with ca, fuo, gdp, gtp, mes, mg |
PDB Entry: 7cbz (more details), 2.61 Å
SCOPe Domain Sequences for d7cbza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cbza2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvd
Timeline for d7cbza2: