SCOPe 2.07: Domain d7cbza2: 7cbz A:246-438

Lineage for d7cbza2 (7cbz A:246-438)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
Domain d7cbza2: 7cbz A:246-438 [404686]
Other proteins in same PDB: d7cbza1, d7cbzb1, d7cbzc1, d7cbzd1, d7cbze_, d7cbzf1, d7cbzf2
automated match to d4i50a2
complexed with ca, fuo, gdp, gtp, mes, mg

Details for d7cbza2

PDB Entry: 7cbz (more details), 2.61 Å

PDB Description: crystal structure of t2r-ttl-a31 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d7cbza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cbza2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

SCOPe Domain Coordinates for d7cbza2:

Click to download the PDB-style file with coordinates for d7cbza2.
(The format of our PDB-style files is described here.)

Timeline for d7cbza2: