SCOPe 2.08: Domain d7ce6e_: 7ce6 E:

Lineage for d7ce6e_ (7ce6 E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d7ce6e_: 7ce6 E: [404655]
   Other proteins in same PDB: d7ce6a1, d7ce6a2, d7ce6b1, d7ce6b2, d7ce6c1, d7ce6c2, d7ce6d1, d7ce6d2, d7ce6f1, d7ce6f2, d7ce6f3
   automated match to d4i55e_
   complexed with acp, af6, ca, gdp, gol, gtp, mes, mg

Details for d7ce6e_

PDB Entry: 7ce6, 2.7 Å

PDB Description: crystal structure of t2r-ttl-compound9 complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d7ce6e_:

Sequence, based on SEQRES records:

>d7ce6e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d7ce6e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d7ce6e_:

• d7ce6e_ first appeared in SCOPe 2.07