Lineage for d1ayba_ (1ayb A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82613Protein Tyrosine phosphatase Syp [55561] (1 species)
  7. 82614Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries)
  8. 82619Domain d1ayba_: 1ayb A: [40464]

Details for d1ayba_

PDB Entry: 1ayb (more details), 3 Å

PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase

SCOP Domain Sequences for d1ayba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayba_ d.93.1.1 (A:) Tyrosine phosphatase Syp {Mouse (Mus musculus)}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkypln

SCOP Domain Coordinates for d1ayba_:

Click to download the PDB-style file with coordinates for d1ayba_.
(The format of our PDB-style files is described here.)

Timeline for d1ayba_: