Lineage for d1ayca_ (1ayc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965652Protein Tyrosine phosphatase Syp [55561] (1 species)
  7. 2965653Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries)
  8. 2965657Domain d1ayca_: 1ayc A: [40463]

Details for d1ayca_

PDB Entry: 1ayc (more details), 2.3 Å

PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
PDB Compounds: (A:) protein-tyrosine phosphatase syp (n-terminal sh2 domain)

SCOPe Domain Sequences for d1ayca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayca_ d.93.1.1 (A:) Tyrosine phosphatase Syp {Mouse (Mus musculus) [TaxId: 10090]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkypln

SCOPe Domain Coordinates for d1ayca_:

Click to download the PDB-style file with coordinates for d1ayca_.
(The format of our PDB-style files is described here.)

Timeline for d1ayca_: