Lineage for d1ayd__ (1ayd -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (19 proteins) 
Protein Tyrosine phosphatase Syp [55561] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries) 
Domain d1ayd__: 1ayd - [40462]
Details for d1ayd__
PDB Entry: 1ayd (more details), 2.2 Å
PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
SCOP Domain Sequences for d1ayd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayd__ d.93.1.1 (-) Tyrosine phosphatase Syp {Mouse (Mus musculus)}
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln
SCOP Domain Coordinates for d1ayd__:
Click to download the PDB-style file with coordinates for d1ayd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayd__:
- d1ayd__ appears in SCOP 1.57
- d1ayd__ appears in the current release, SCOPe 2.08, called d1ayda_
View in 3D