Lineage for d1ayda_ (1ayd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965652Protein Tyrosine phosphatase Syp [55561] (1 species)
  7. 2965653Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries)
  8. 2965656Domain d1ayda_: 1ayd A: [40462]

Details for d1ayda_

PDB Entry: 1ayd (more details), 2.2 Å

PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
PDB Compounds: (A:) protein-tyrosine phosphatase syp (n-terminal sh2 domain)

SCOPe Domain Sequences for d1ayda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayda_ d.93.1.1 (A:) Tyrosine phosphatase Syp {Mouse (Mus musculus) [TaxId: 10090]}
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln

SCOPe Domain Coordinates for d1ayda_:

Click to download the PDB-style file with coordinates for d1ayda_.
(The format of our PDB-style files is described here.)

Timeline for d1ayda_: