| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
| Domain d7ce6c1: 7ce6 C:1-245 [404617] Other proteins in same PDB: d7ce6a2, d7ce6b2, d7ce6c2, d7ce6d2, d7ce6e_, d7ce6f1, d7ce6f2, d7ce6f3 automated match to d5fnva1 complexed with acp, af6, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 7ce6 (more details), 2.7 Å
SCOPe Domain Sequences for d7ce6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ce6c1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d7ce6c1: