SCOP 1.61: Domain d1ayab_: 1aya B:

Lineage for d1ayab_ (1aya B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein Tyrosine phosphatase Syp [55561] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries)

8. Domain d1ayab_: 1aya B: [40461]

Details for d1ayab_

PDB Entry: 1aya, 2.05 Å

PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase

SCOP Domain Sequences for d1ayab_:

Sequence; same for both SEQRES and ATOM records:

>d1ayab_ d.93.1.1 (B:) Tyrosine phosphatase Syp {Mouse (Mus musculus)}
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln

Timeline for d1ayab_:

• d1ayab_ first appeared (with stable ids) in SCOP 1.55
  
• d1ayab_ appears in SCOP 1.59
  
• d1ayab_ appears in SCOP 1.63
  
• d1ayab_ appears in the current release, SCOPe 2.08