Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Tyrosine phosphatase Syp [55561] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries) |
Domain d1ayab_: 1aya B: [40461] |
PDB Entry: 1aya (more details), 2.05 Å
SCOPe Domain Sequences for d1ayab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayab_ d.93.1.1 (B:) Tyrosine phosphatase Syp {Mouse (Mus musculus) [TaxId: 10090]} mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy ydlyggekfatlaelvqyymehhgqlkekngdvielkypln
Timeline for d1ayab_: