SCOP 1.63: Domain d1ayaa_: 1aya A:

Lineage for d1ayaa_ (1aya A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (22 proteins)

6. Protein Tyrosine phosphatase Syp [55561] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries)

8. Domain d1ayaa_: 1aya A: [40460]

Details for d1ayaa_

PDB Entry: 1aya, 2.05 Å

PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase

SCOP Domain Sequences for d1ayaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ayaa_ d.93.1.1 (A:) Tyrosine phosphatase Syp {Mouse (Mus musculus)}
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln

Timeline for d1ayaa_:

• d1ayaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ayaa_ appears in SCOP 1.61
  
• d1ayaa_ appears in SCOP 1.65
  
• d1ayaa_ appears in the current release, SCOPe 2.08