Lineage for d1ayaa_ (1aya A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34680Protein Tyrosine phosphatase Syp [55561] (1 species)
  7. 34681Species Mouse (Mus musculus) [TaxId:10090] [55562] (4 PDB entries)
  8. 34682Domain d1ayaa_: 1aya A: [40460]

Details for d1ayaa_

PDB Entry: 1aya (more details), 2.05 Å

PDB Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase

SCOP Domain Sequences for d1ayaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayaa_ d.93.1.1 (A:) Tyrosine phosphatase Syp {Mouse (Mus musculus)}
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln

SCOP Domain Coordinates for d1ayaa_:

Click to download the PDB-style file with coordinates for d1ayaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ayaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ayab_