SCOPe 2.08: Domain d7cb2a2: 7cb2 A:176-466

Lineage for d7cb2a2 (7cb2 A:176-466)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [401774] (4 PDB entries)

8. Domain d7cb2a2: 7cb2 A:176-466 [404591]
   Other proteins in same PDB: d7cb2a1, d7cb2b1, d7cb2c1, d7cb2d1
   automated match to d2w90a2
   complexed with cit, nap, no3

Details for d7cb2a2

PDB Entry: 7cb2, 2.15 Å

PDB Description: the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d7cb2a2:

Sequence; same for both SEQRES and ATOM records:

>d7cb2a2 a.100.1.0 (A:176-466) automated matches {Staphylococcus aureus [TaxId: 426430]}
gaghyvkmvhngieyadmqliaesyammkellgmshediaqtfkdwnagelesylieitg
difmkldenkealvekildtagqkgtgkwtsinalelgipltiitesvfarfissikeer
vnaskelngpkasfdgdkkdflekirkalymskicsyaqgfaqmrkasednewnlklgdl
amiwregciiraqflqkikdaydnnpglqnllldpyfknivteyqdalrdvvatgvqngv
ptpgfsssinyydsyraadlpanliqaqrdyfgahtyerkdkegvfhtqwi

Timeline for d7cb2a2:

• d7cb2a2 first appeared in SCOPe 2.07