SCOPe 2.07: Domain d7cbjb_: 7cbj B:

Lineage for d7cbjb_ (7cbj B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
   Uniprot Q08499 388-713

8. Domain d7cbjb_: 7cbj B: [404589]
   automated match to d1xora_
   complexed with edo, ftx, mg, zn

Details for d7cbjb_

PDB Entry: 7cbj, 1.5 Å

PDB Description: crystal structure of pde4d catalytic domain in complex with compound 36

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d7cbjb_:

Sequence; same for both SEQRES and ATOM records:

>d7cbjb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
edvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmt
ledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvs
nqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidiv
latdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplql
yrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlv
hpdaqdildtlednrewyqstip

Timeline for d7cbjb_:

• d7cbjb_ is new in SCOPe 2.07-stable
  
• d7cbjb_ appears in the current release, SCOPe 2.08