Lineage for d1f2fa_ (1f2f A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82458Protein c-src tyrosine kinase [55556] (2 species)
  7. 82459Species Chicken (Gallus gallus) [TaxId:9031] [55558] (3 PDB entries)
  8. 82460Domain d1f2fa_: 1f2f A: [40455]

Details for d1f2fa_

PDB Entry: 1f2f (more details), 1.7 Å

PDB Description: src sh2 thref1trp mutant

SCOP Domain Sequences for d1f2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2fa_ d.93.1.1 (A:) c-src tyrosine kinase {Chicken (Gallus gallus)}
maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1f2fa_:

Click to download the PDB-style file with coordinates for d1f2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1f2fa_: