SCOPe 2.07: Domain d7b7uj

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)
automatically mapped to Pfam PF01194
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
Zn-binding site is near the N-terminus
Protein automated matches [190336] (5 species)
not a true protein
Species Sus scrofa [TaxId:9825] [404546] (1 PDB entry)
Domain d7b7uj_: 7b7u J: [404547]
Other proteins in same PDB: d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uk_, d7b7ul_
automated match to d4c2mj_
protein/RNA complex; complexed with zn

PDB Entry: 7b7u (more details), 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2

PDB Compounds: (J:) Uncharacterized protein

SCOPe Domain Sequences for d7b7uj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7uj_ a.4.11.1 (J:) automated matches {Sus scrofa [TaxId: 9825]}
miipvrcftcgkivgnkweaylgllqaeytegdaldalglkryccrrmllahvdliekll
nyaplek

SCOPe Domain Coordinates for d7b7uj_:

Click to download the PDB-style file with coordinates for d7b7uj_.
(The format of our PDB-style files is described here.)

Timeline for d7b7uj_:

Thumbnails for d7b7uj_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7b7uf_, d7b7uh_, d7b7ui1, d7b7ui2, d7b7uk_, d7b7ul_