SCOPe 2.08: Domain d7ce6f1: 7ce6 F:1-76

Lineage for d7ce6f1 (7ce6 F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d7ce6f1: 7ce6 F:1-76 [404540]
   Other proteins in same PDB: d7ce6a1, d7ce6a2, d7ce6b1, d7ce6b2, d7ce6c1, d7ce6c2, d7ce6d1, d7ce6d2, d7ce6e_, d7ce6f2, d7ce6f3
   automated match to d3tiia1
   complexed with acp, af6, ca, gdp, gol, gtp, mes, mg

Details for d7ce6f1

PDB Entry: 7ce6, 2.7 Å

PDB Description: crystal structure of t2r-ttl-compound9 complex

PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d7ce6f1:

Sequence; same for both SEQRES and ATOM records:

>d7ce6f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d7ce6f1:

• d7ce6f1 first appeared in SCOPe 2.07