Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries) |
Domain d1hctb_: 1hct B: [40454] |
PDB Entry: 1hct (more details)
SCOPe Domain Sequences for d1hctb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hctb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
Timeline for d1hctb_: