Lineage for d1hctb_ (1hct B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82458Protein c-src tyrosine kinase [55556] (2 species)
  7. 82463Species Human (Homo sapiens) [TaxId:9606] [55557] (12 PDB entries)
  8. 82482Domain d1hctb_: 1hct B: [40454]

Details for d1hctb_

PDB Entry: 1hct (more details)

PDB Description: nmr structure of the human src sh2 domain complex

SCOP Domain Sequences for d1hctb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hctb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens)}
mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOP Domain Coordinates for d1hctb_:

Click to download the PDB-style file with coordinates for d1hctb_.
(The format of our PDB-style files is described here.)

Timeline for d1hctb_: