SCOPe 2.08: Domain d7c3sb1: 7c3s B:1-181

Lineage for d7c3sb1 (7c3s B:1-181)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Putative deaminase NE0047 [142833] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries)
   Uniprot Q82Y41 1-189

8. Domain d7c3sb1: 7c3s B:1-181 [404533]
   Other proteins in same PDB: d7c3sb2
   automated match to d2g84a1
   complexed with azg, edo, gol, zn; mutant

Details for d7c3sb1

PDB Entry: 7c3s, 1.66 Å

PDB Description: crystal structure of ne0047 (e143d) mutant in complex with 8- azaguanine

PDB Compounds: (B:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d7c3sb1:

Sequence; same for both SEQRES and ATOM records:

>d7c3sb1 c.97.1.2 (B:1-181) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfddgprpenwmggleargitvttgllrdaacallreynac
n

Timeline for d7c3sb1:

• d7c3sb1 first appeared in SCOPe 2.07