SCOPe 2.05: Domain d1hcsb_: 1hcs B:

Lineage for d1hcsb_ (1hcs B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)

8. Domain d1hcsb_: 1hcs B: [40453]

Details for d1hcsb_

PDB Entry: 1hcs

PDB Description: nmr structure of the human src sh2 domain complex

PDB Compounds: (B:) human src

SCOPe Domain Sequences for d1hcsb_:

Sequence; same for both SEQRES and ATOM records:

>d1hcsb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

Timeline for d1hcsb_:

• d1hcsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hcsb_ appears in SCOPe 2.04
  
• d1hcsb_ appears in SCOPe 2.06
  
• d1hcsb_ appears in the current release, SCOPe 2.08