Lineage for d1hcsb_ (1hcs B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1661882Protein c-src tyrosine kinase [55556] (3 species)
  7. 1661889Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 1661941Domain d1hcsb_: 1hcs B: [40453]

Details for d1hcsb_

PDB Entry: 1hcs (more details)

PDB Description: nmr structure of the human src sh2 domain complex
PDB Compounds: (B:) human src

SCOPe Domain Sequences for d1hcsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcsb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOPe Domain Coordinates for d1hcsb_:

Click to download the PDB-style file with coordinates for d1hcsb_.
(The format of our PDB-style files is described here.)

Timeline for d1hcsb_: