Lineage for d1a1cb_ (1a1c B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965253Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 2965303Domain d1a1cb_: 1a1c B: [40452]

Details for d1a1cb_

PDB Entry: 1a1c (more details), 2.4 Å

PDB Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(n-me(-(ch2)3- cyclopentyl))
PDB Compounds: (B:) c-src tyrosine kinase

SCOPe Domain Sequences for d1a1cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1cb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOPe Domain Coordinates for d1a1cb_:

Click to download the PDB-style file with coordinates for d1a1cb_.
(The format of our PDB-style files is described here.)

Timeline for d1a1cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a1ca_