Lineage for d7c3ta_ (7c3t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918597Protein Putative deaminase NE0047 [142833] (1 species)
  7. 2918598Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries)
    Uniprot Q82Y41 1-189
  8. 2918611Domain d7c3ta_: 7c3t A: [404509]
    Other proteins in same PDB: d7c3tb2
    automated match to d2g84a1
    complexed with azg, zn; mutant

Details for d7c3ta_

PDB Entry: 7c3t (more details), 2.07 Å

PDB Description: crystal structure of ne0047 (n66q) mutant in complex with 8-azaguanine
PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d7c3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c3ta_ c.97.1.2 (A:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
dalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgllia
agtqrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgaviws
gvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynacng
viynarc

SCOPe Domain Coordinates for d7c3ta_:

Click to download the PDB-style file with coordinates for d7c3ta_.
(The format of our PDB-style files is described here.)

Timeline for d7c3ta_: