SCOPe 2.08: Domain d1a1aa_: 1a1a A:

Lineage for d1a1aa_ (1a1a A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)

8. Domain d1a1aa_: 1a1a A: [40449]
   mutant

Details for d1a1aa_

PDB Entry: 1a1a, 2 Å

PDB Description: c-src (sh2 domain with c188a mutation) complexed with ace-formyl phosphotyr-glu-(n,n-dipentyl amine)

PDB Compounds: (A:) c-src tyrosine kinase

SCOPe Domain Sequences for d1a1aa_:

Sequence; same for both SEQRES and ATOM records:

>d1a1aa_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
dsiqaeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnvk
hykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

Timeline for d1a1aa_:

• d1a1aa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a1aa_ appears in SCOPe 2.07