Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) |
Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
Protein alpha-actinin [46971] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46972] (3 PDB entries) |
Domain d7a8ta4: 7a8t A:633-746 [404489] Other proteins in same PDB: d7a8ta5 automated match to d1hcia4 |
PDB Entry: 7a8t (more details), 2.69 Å
SCOPe Domain Sequences for d7a8ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a8ta4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} hanerlrrqfaaqanaigpwiqnkmeeiarssiqitgaledqmnqlkqyehniinyknni dklegdhqliqealvfdnkhtnytmehirvgwelllttiartinevetqiltrd
Timeline for d7a8ta4:
View in 3D Domains from same chain: (mouse over for more information) d7a8ta1, d7a8ta2, d7a8ta3, d7a8ta5 |