SCOP 1.69: Domain d1a08b_: 1a08 B:

Lineage for d1a08b_ (1a08 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (30 proteins)
   Pfam 00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)

8. Domain d1a08b_: 1a08 B: [40448]

Details for d1a08b_

PDB Entry: 1a08, 2.2 Å

PDB Description: c-src (sh2 domain) complexed with ace-difluoro phosphotyr-glu-(n,n- dipentyl amine)

SCOP Domain Sequences for d1a08b_:

Sequence; same for both SEQRES and ATOM records:

>d1a08b_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens)}
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

Timeline for d1a08b_:

• d1a08b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a08b_ appears in SCOP 1.67
  
• d1a08b_ appears in SCOP 1.71
  
• d1a08b_ appears in the current release, SCOPe 2.08