Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
Domain d7bnwd1: 7bnw D:2-111 [404476] Other proteins in same PDB: d7bnwa2, d7bnwb2, d7bnwc2, d7bnwd2 automated match to d4w81a_ |
PDB Entry: 7bnw (more details), 2.59 Å
SCOPe Domain Sequences for d7bnwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bnwd1 b.1.1.1 (D:2-111) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesgggsvqaggslrlscaasgvpsssrvmgwfrqapgkqrefvaaiswtsgnvyya dsvkgrftitrdnakntmylqmdslkpedtavyycnarrirfgvrvydywgqgtqvtv
Timeline for d7bnwd1: