Lineage for d7asia2 (7asi A:103-171)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400158Species Neurospora crassa [TaxId:5141] [404421] (2 PDB entries)
  8. 2400159Domain d7asia2: 7asi A:103-171 [404470]
    Other proteins in same PDB: d7asia1
    automated match to d1khia2

Details for d7asia2

PDB Entry: 7asi (more details), 1.7 Å

PDB Description: fixed-target serial femtosecond crystallography using in cellulo grown neurospora crassa hex-1 microcrystals. (chips 1+2)
PDB Compounds: (A:) eIF-5a domain-containing protein

SCOPe Domain Sequences for d7asia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7asia2 b.40.4.0 (A:103-171) automated matches {Neurospora crassa [TaxId: 5141]}
fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr
emavdmkvv

SCOPe Domain Coordinates for d7asia2:

Click to download the PDB-style file with coordinates for d7asia2.
(The format of our PDB-style files is described here.)

Timeline for d7asia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7asia1