Lineage for d7asia2 (7asi A:103-171)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.0: automated matches [191416] (1 protein)
not a true familyProtein automated matches [190576] (52 species)
not a true protein
Species Fungus (Neurospora crassa) [TaxId:5141] [404421] (2 PDB entries) 
Domain d7asia2: 7asi A:103-171 [404470]
Other proteins in same PDB: d7asia1
automated match to d1khia2
Details for d7asia2
PDB Entry: 7asi (more details), 1.7 Å
PDB Description: fixed-target serial femtosecond crystallography using in cellulo grown neurospora crassa hex-1 microcrystals. (chips 1+2)
PDB Compounds: (A:) eIF-5a domain-containing proteinSCOPe Domain Sequences for d7asia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7asia2 b.40.4.0 (A:103-171) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]}
fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr
emavdmkvv
SCOPe Domain Coordinates for d7asia2:
Click to download the PDB-style file with coordinates for d7asia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7asia2:
- d7asia2 first appeared in SCOPe 2.07
View in 3D
