Lineage for d1a08a_ (1a08 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34531Protein c-src tyrosine kinase [55556] (2 species)
  7. 34536Species Human (Homo sapiens) [TaxId:9606] [55557] (12 PDB entries)
  8. 34548Domain d1a08a_: 1a08 A: [40447]

Details for d1a08a_

PDB Entry: 1a08 (more details), 2.2 Å

PDB Description: c-src (sh2 domain) complexed with ace-difluoro phosphotyr-glu-(n,n- dipentyl amine)

SCOP Domain Sequences for d1a08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a08a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOP Domain Coordinates for d1a08a_:

Click to download the PDB-style file with coordinates for d1a08a_.
(The format of our PDB-style files is described here.)

Timeline for d1a08a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a08b_