Lineage for d1a08a_ (1a08 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. Protein c-src tyrosine kinase [55556] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. Domain d1a08a_: 1a08 A: [40447]

Details for d1a08a_

PDB Entry: 1a08 (more details), 2.2 Å

PDB Description: c-src (sh2 domain) complexed with ace-difluoro phosphotyr-glu-(n,n- dipentyl amine)
PDB Compounds: (A:) c-src tyrosine kinase

SCOPe Domain Sequences for d1a08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a08a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOPe Domain Coordinates for d1a08a_ are not available.

Timeline for d1a08a_:

Domains from other chains:
(mouse over for more information)
d1a08b_