SCOPe 2.08: Domain d7asia1: 7asi A:31-102

Lineage for d7asia1 (7asi A:31-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)

6. Protein automated matches [404417] (1 species)
   not a true protein

7. Species Fungus (Neurospora crassa) [TaxId:5141] [404418] (2 PDB entries)

8. Domain d7asia1: 7asi A:31-102 [404469]
   Other proteins in same PDB: d7asia2
   automated match to d1khia1

Details for d7asia1

PDB Entry: 7asi, 1.7 Å

PDB Description: fixed-target serial femtosecond crystallography using in cellulo grown neurospora crassa hex-1 microcrystals. (chips 1+2)

PDB Compounds: (A:) eIF-5a domain-containing protein

SCOPe Domain Sequences for d7asia1:

Sequence; same for both SEQRES and ATOM records:

>d7asia1 b.34.5.2 (A:31-102) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]}
qtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfvsnpa
psvvvqtmlgpv

Timeline for d7asia1:

• d7asia1 first appeared in SCOPe 2.07