Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins) |
Protein automated matches [404417] (1 species) not a true protein |
Species Fungus (Neurospora crassa) [TaxId:5141] [404418] (2 PDB entries) |
Domain d7asia1: 7asi A:31-102 [404469] Other proteins in same PDB: d7asia2 automated match to d1khia1 |
PDB Entry: 7asi (more details), 1.7 Å
SCOPe Domain Sequences for d7asia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7asia1 b.34.5.2 (A:31-102) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]} qtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfvsnpa psvvvqtmlgpv
Timeline for d7asia1: