SCOPe 2.08: Domain d7azwa1: 7azw A:1-114

Lineage for d7azwa1 (7azw A:1-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d7azwa1: 7azw A:1-114 [404463]
   Other proteins in same PDB: d7azwa2
   automated match to d5n1xb_
   complexed with gol

Details for d7azwa1

PDB Entry: 7azw, 2.1 Å

PDB Description: crystal structure of the miz1-btb-domain

PDB Compounds: (A:) zinc finger and BTB domain-containing protein 17 isoform X1

SCOPe Domain Sequences for d7azwa1:

Sequence; same for both SEQRES and ATOM records:

>d7azwa1 d.42.1.0 (A:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvv
hldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksl

Timeline for d7azwa1:

• d7azwa1 first appeared in SCOPe 2.07