Lineage for d1a1eb_ (1a1e B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82458Protein c-src tyrosine kinase [55556] (2 species)
  7. 82463Species Human (Homo sapiens) [TaxId:9606] [55557] (12 PDB entries)
  8. 82474Domain d1a1eb_: 1a1e B: [40446]

Details for d1a1eb_

PDB Entry: 1a1e (more details), 2.2 Å

PDB Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(3- butylpiperidine)

SCOP Domain Sequences for d1a1eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1eb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens)}
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOP Domain Coordinates for d1a1eb_:

Click to download the PDB-style file with coordinates for d1a1eb_.
(The format of our PDB-style files is described here.)

Timeline for d1a1eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a1ea_