Lineage for d7b7ui2 (7b7u I:60-125)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641064Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 2641179Family g.41.3.0: automated matches [404449] (1 protein)
    not a true family
  6. 2641180Protein automated matches [404450] (1 species)
    not a true protein
  7. 2641181Species Sus scrofa [TaxId:9825] [404451] (1 PDB entry)
  8. 2641183Domain d7b7ui2: 7b7u I:60-125 [404453]
    Other proteins in same PDB: d7b7uf_, d7b7uh_, d7b7uj_, d7b7uk_, d7b7ul_
    automated match to d1i50i2
    protein/RNA complex; complexed with zn

Details for d7b7ui2

PDB Entry: 7b7u (more details), 2.8 Å

PDB Description: cryo-em structure of mammalian rna polymerase ii in complex with human rpap2
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d7b7ui2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7ui2 g.41.3.0 (I:60-125) automated matches {Sus scrofa [TaxId: 9825]}
hevdeltqiiadvsqdptlprtedhpcqkcghkeavffqshsaraedamrlyyvctaphc
ghrwte

SCOPe Domain Coordinates for d7b7ui2:

Click to download the PDB-style file with coordinates for d7b7ui2.
(The format of our PDB-style files is described here.)

Timeline for d7b7ui2:

2641183
d7b7ui2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7b7ui1