SCOPe 2.08: Domain d7b03c_: 7b03 C:

Lineage for d7b03c_ (7b03 C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Uncultured gammaproteobacteria [TaxId:86473] [404425] (1 PDB entry)

8. Domain d7b03c_: 7b03 C: [404443]
   automated match to d4jq6a_
   complexed with ret

Details for d7b03c_

PDB Entry: 7b03, 2.93 Å

PDB Description: cryo-em structure of the green-light absorbing proteorhodopsin

PDB Compounds: (C:) Proteorhodopsin

SCOPe Domain Sequences for d7b03c_:

Sequence, based on SEQRES records:

>d7b03c_ f.13.1.0 (C:) automated matches {Uncultured gammaproteobacteria [TaxId: 86473]}
dasdytgvsfwlvtaallastvfffverdrvsakwktsltvsglvtgiafwhymymrgvw
ietgdsptvfryidwlltvpllicefylilaaatnvagslfkkllvgslvmlvfgymgea
gimaawpafiigclawvymiyelwagegksacntaspavqsayntmmyiiifgwaiypvg
yftgylmgdggsalnlnliynladfvnkilfgliiwnvavkessn

Sequence, based on observed residues (ATOM records):

>d7b03c_ f.13.1.0 (C:) automated matches {Uncultured gammaproteobacteria [TaxId: 86473]}
dasdytgvsfwlvtaallastvfffverdrvsakwktsltvsglvtgiafwhymymrgvw
ietgdsptvfryidwlltvpllicefylilaaatnvagslfkkllvgslvmlvfgymgea
gimaawpafiigclawvymiyelwagegksacntaspavqsayntmmyiiifgwaiypvg
yftgylnlnliynladfvnkilfgliiwnvavkessn

Timeline for d7b03c_:

• d7b03c_ first appeared in SCOPe 2.07