Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (20 proteins) |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55557] (13 PDB entries) |
Domain d1a07b_: 1a07 B: [40444] |
PDB Entry: 1a07 (more details), 2.2 Å
SCOP Domain Sequences for d1a07b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a07b_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens)} iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
Timeline for d1a07b_: