SCOPe 2.08: Domain d7b93f2: 7b93 F:254-339

Lineage for d7b93f2 (7b93 F:254-339)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families)
   possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster

5. Family d.15.13.0: automated matches [254297] (1 protein)
   not a true family

6. Protein automated matches [254683] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [394204] (4 PDB entries)

8. Domain d7b93f2: 7b93 F:254-339 [404432]
   Other proteins in same PDB: d7b93f1, d7b93f3, d7b93t_, d7b93u_, d7b93w_
   automated match to d2fug13
   complexed with 3pe, atp, cdl, ehz, fes, fmn, ndp, pc1, sf4, t2q, zn

Details for d7b93f2

PDB Entry: 7b93, 3.04 Å

PDB Description: cryo-em structure of mitochondrial complex i from mus musculus inhibited by iacs-2858 at 3.0 a

PDB Compounds: (F:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d7b93f2:

Sequence; same for both SEQRES and ATOM records:

>d7b93f2 d.15.13.0 (F:254-339) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klfnisghvnhpctveeemsvplkeliekhaggvtggwdnllavipggsstplipksvce
tvlmdfdalvqaqtglgtaavivmdr

Timeline for d7b93f2:

• d7b93f2 first appeared in SCOPe 2.07