![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) |
![]() | Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (19 proteins) |
![]() | Protein c-src tyrosine kinase [55556] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55557] (12 PDB entries) |
![]() | Domain d1a1bb_: 1a1b B: [40442] |
PDB Entry: 1a1b (more details), 2.2 Å
SCOP Domain Sequences for d1a1bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1bb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens)} iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
Timeline for d1a1bb_: