Lineage for d1a1bb_ (1a1b B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (19 proteins) 
Protein c-src tyrosine kinase [55556] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55557] (12 PDB entries) 
Domain d1a1bb_: 1a1b B: [40442]
Details for d1a1bb_
PDB Entry: 1a1b (more details), 2.2 Å
PDB Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(n,n-dipentyl amine)
SCOP Domain Sequences for d1a1bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1bb_ d.93.1.1 (B:) c-src tyrosine kinase {Human (Homo sapiens)}
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
SCOP Domain Coordinates for d1a1bb_:
Click to download the PDB-style file with coordinates for d1a1bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a1bb_:
- d1a1bb_ appears in SCOP 1.57
- d1a1bb_ appears in the current release, SCOPe 2.08
View in 3D
