Lineage for d7asxa1 (7asx A:31-102)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393545Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2393686Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)
  6. 2393711Protein automated matches [404417] (1 species)
    not a true protein
  7. 2393712Species Neurospora crassa [TaxId:5141] [404418] (2 PDB entries)
  8. 2393714Domain d7asxa1: 7asx A:31-102 [404419]
    Other proteins in same PDB: d7asxa2
    automated match to d1khia1

Details for d7asxa1

PDB Entry: 7asx (more details), 1.8 Å

PDB Description: fixed-target serial femtosecond crystallography using in cellulo grown neurospora crassa hex-1 microcrystals. (chip 1)
PDB Compounds: (A:) eIF-5a domain-containing protein

SCOPe Domain Sequences for d7asxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7asxa1 b.34.5.2 (A:31-102) automated matches {Neurospora crassa [TaxId: 5141]}
qtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfvsnpa
psvvvqtmlgpv

SCOPe Domain Coordinates for d7asxa1:

Click to download the PDB-style file with coordinates for d7asxa1.
(The format of our PDB-style files is described here.)

Timeline for d7asxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7asxa2