Lineage for d7av6a1 (7av6 A:25-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2576906Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2576907Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 2576908Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (82 PDB entries)
    Uniprot P16113
  8. 2576937Domain d7av6a1: 7av6 A:25-125 [404411]
    Other proteins in same PDB: d7av6a2
    automated match to d2i9va_
    complexed with fmt

Details for d7av6a1

PDB Entry: 7av6 (more details), 1.5 Å

PDB Description: fast in a domain-swapped dimer form
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d7av6a1:

Sequence, based on SEQRES records: (download)

>d7av6a1 d.110.3.1 (A:25-125) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
glafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapgtdspefygkfkegva
sgnlntmfewmiptsrgptkvkvhmkkalsgdsywvfvkrv

Sequence, based on observed residues (ATOM records): (download)

>d7av6a1 d.110.3.1 (A:25-125) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
glafgaiqldgdgnilqynaditgrdpkqvigknffkdvapgtdspefygkfkegvasgn
lntmfewmiptsrgptkvkvhmkkalsgdsywvfvkrv

SCOPe Domain Coordinates for d7av6a1:

Click to download the PDB-style file with coordinates for d7av6a1.
(The format of our PDB-style files is described here.)

Timeline for d7av6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7av6a2