Lineage for d1shda_ (1shd A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein c-src tyrosine kinase [55556] (3 species) Species Human (Homo sapiens) [TaxId:9606] [55557] (13 PDB entries) 
Domain d1shda_: 1shd A: [40440]
Details for d1shda_
PDB Entry: 1shd (more details), 2 Å
PDB Description: peptide inhibitors of src sh3-sh2-phosphoprotein interactions
SCOP Domain Sequences for d1shda_:
Sequence, based on SEQRES records: (download)
>d1shda_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
Sequence, based on observed residues (ATOM records): (download)
>d1shda_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvreseayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
SCOP Domain Coordinates for d1shda_:
Click to download the PDB-style file with coordinates for d1shda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1shda_:
- d1shda_ first appeared (with stable ids) in SCOP 1.55
- d1shda_ appears in SCOP 1.57
- d1shda_ appears in SCOP 1.61
- d1shda_ appears in the current release, SCOPe 2.08
View in 3D