Lineage for d6ztrj2 (6ztr J:209-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763541Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)
  8. 2763554Domain d6ztrj2: 6ztr J:209-321 [404385]
    Other proteins in same PDB: d6ztrb1, d6ztrb2, d6ztrl1, d6ztrl2
    automated match to d1ff5a2
    complexed with ca

Details for d6ztrj2

PDB Entry: 6ztr (more details), 2.1 Å

PDB Description: crystal structure of the anti-human p-cadherin fab cqy684 in complex with human p-cadherin(108-324)
PDB Compounds: (J:) Cadherin-3

SCOPe Domain Sequences for d6ztrj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ztrj2 b.1.6.0 (J:209-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveilda

SCOPe Domain Coordinates for d6ztrj2:

Click to download the PDB-style file with coordinates for d6ztrj2.
(The format of our PDB-style files is described here.)

Timeline for d6ztrj2: