Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries) |
Domain d6zhvb_: 6zhv B: [404383] automated match to d2zfga_ complexed with mg, na, qlb |
PDB Entry: 6zhv (more details), 1.95 Å
SCOPe Domain Sequences for d6zhvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zhvb_ f.4.3.1 (B:) Porin {Escherichia coli, different sequences [TaxId: 562]} aaeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgyg qweynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefg gdtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsis yeyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatp itnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevga tyyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
Timeline for d6zhvb_: