Lineage for d6zh5f1 (6zh5 F:2-183)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702643Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries)
  8. 2702703Domain d6zh5f1: 6zh5 F:2-183 [404378]
    Other proteins in same PDB: d6zh5a2, d6zh5b2, d6zh5c2, d6zh5d2, d6zh5e2, d6zh5f2, d6zh5g2, d6zh5h2, d6zh5i2, d6zh5j2, d6zh5k2, d6zh5l2, d6zh5m2, d6zh5n2, d6zh5o2, d6zh5p2, d6zh5q2, d6zh5r2, d6zh5s2, d6zh5t2, d6zh5u2, d6zh5v2, d6zh5w2, d6zh5z2
    automated match to d1iera_
    complexed with fe

Details for d6zh5f1

PDB Entry: 6zh5 (more details), 2.7 Å

PDB Description: folding of an iron binding peptide in response to sedimentation is resolved using ferritin as a nano-reactor
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d6zh5f1:

Sequence, based on SEQRES records: (download)

>d6zh5f1 a.25.1.1 (F:2-183) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
adphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk
hd

Sequence, based on observed residues (ATOM records): (download)

>d6zh5f1 a.25.1.1 (F:2-183) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
adphlcdfleshyldkevklikkmgnhltnlrrvaslgeylferltlkhd

SCOPe Domain Coordinates for d6zh5f1:

Click to download the PDB-style file with coordinates for d6zh5f1.
(The format of our PDB-style files is described here.)

Timeline for d6zh5f1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6zh5f2
View in 3D
Domains from other chains:
(mouse over for more information)
d6zh5a1, d6zh5a2, d6zh5b1, d6zh5b2, d6zh5c1, d6zh5c2, d6zh5d1, d6zh5d2, d6zh5e1, d6zh5e2, d6zh5g1, d6zh5g2, d6zh5h1, d6zh5h2, d6zh5i1, d6zh5i2, d6zh5j1, d6zh5j2, d6zh5k1, d6zh5k2, d6zh5l1, d6zh5l2, d6zh5m1, d6zh5m2, d6zh5n1, d6zh5n2, d6zh5o1, d6zh5o2, d6zh5p1, d6zh5p2, d6zh5q1, d6zh5q2, d6zh5r1, d6zh5r2, d6zh5s1, d6zh5s2, d6zh5t1, d6zh5t2, d6zh5u1, d6zh5u2, d6zh5v1, d6zh5v2, d6zh5w1, d6zh5w2, d6zh5z1, d6zh5z2