Lineage for d2src_2 (2src 146-248)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 135979Protein c-src tyrosine kinase [55556] (3 species)
  7. 135984Species Human (Homo sapiens) [TaxId:9606] [55557] (13 PDB entries)
  8. 135986Domain d2src_2: 2src 146-248 [40437]
    Other proteins in same PDB: d2src_1, d2src_3

Details for d2src_2

PDB Entry: 2src (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp

SCOP Domain Sequences for d2src_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2src_2 d.93.1.1 (146-248) c-src tyrosine kinase {Human (Homo sapiens)}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOP Domain Coordinates for d2src_2:

Click to download the PDB-style file with coordinates for d2src_2.
(The format of our PDB-style files is described here.)

Timeline for d2src_2: