Lineage for d1fmk_2 (1fmk 146-248)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 194879Protein c-src tyrosine kinase [55556] (3 species)
  7. 194884Species Human (Homo sapiens) [TaxId:9606] [55557] (13 PDB entries)
  8. 194885Domain d1fmk_2: 1fmk 146-248 [40436]
    Other proteins in same PDB: d1fmk_1, d1fmk_3

Details for d1fmk_2

PDB Entry: 1fmk (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src

SCOP Domain Sequences for d1fmk_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmk_2 d.93.1.1 (146-248) c-src tyrosine kinase {Human (Homo sapiens)}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOP Domain Coordinates for d1fmk_2:

Click to download the PDB-style file with coordinates for d1fmk_2.
(The format of our PDB-style files is described here.)

Timeline for d1fmk_2: