Lineage for d1spsc_ (1sps C:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136147Protein v-src tyrosine kinase [55554] (1 species)
  7. 136148Species Rous sarcoma virus, Schmidt-ruppin strain a [55555] (7 PDB entries)
  8. 136160Domain d1spsc_: 1sps C: [40435]

Details for d1spsc_

PDB Entry: 1sps (more details), 2.7 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1spsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spsc_ d.93.1.1 (C:) v-src tyrosine kinase {Rous sarcoma virus, Schmidt-ruppin strain a}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1spsc_:

Click to download the PDB-style file with coordinates for d1spsc_.
(The format of our PDB-style files is described here.)

Timeline for d1spsc_: