Lineage for d1spsb_ (1sps B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34687Protein v-src tyrosine kinase [55554] (1 species)
  7. 34688Species Rous sarcoma virus, Schmidt-ruppin strain a [55555] (7 PDB entries)
  8. 34699Domain d1spsb_: 1sps B: [40434]

Details for d1spsb_

PDB Entry: 1sps (more details), 2.7 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms

SCOP Domain Sequences for d1spsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spsb_ d.93.1.1 (B:) v-src tyrosine kinase {Rous sarcoma virus, Schmidt-ruppin strain a}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1spsb_:

Click to download the PDB-style file with coordinates for d1spsb_.
(The format of our PDB-style files is described here.)

Timeline for d1spsb_: