Lineage for d1sprd_ (1spr D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729718Protein c-src tyrosine kinase [55556] (3 species)
  7. 729771Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)
  8. 729789Domain d1sprd_: 1spr D: [40432]
    complexed with po4

Details for d1sprd_

PDB Entry: 1spr (more details), 2.5 Å

PDB Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms
PDB Compounds: (D:) src tyrosine kinase sh2 domain

SCOP Domain Sequences for d1sprd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sprd_ d.93.1.1 (D:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOP Domain Coordinates for d1sprd_:

Click to download the PDB-style file with coordinates for d1sprd_.
(The format of our PDB-style files is described here.)

Timeline for d1sprd_: